CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Feta Cheese Pies

Buttery phyllo triangles stuffed with creamy feta and fresh herbs, baked until golden in under 20 minutes. A Greek classic that feels fancy but tastes like TikTok comfort.

Total time
18 min
Servings
4
Calories
285
Protein
9g
Crispy Feta Cheese Pies
elegantsimplegreekvegetariancheesecrispycreamyflaky

Ingredients

  • 8 sheets phyllo dough (thawed)
  • 1.5 cups feta cheese, crumbled
  • 4 tbsp butter, melted
  • ¼ cup fresh dill and parsley, chopped
  • 1 whole egg
  • ¼ tsp black pepper

Instructions

  1. 1

    Preheat oven to 375°F. Mix feta, dill, parsley, egg, and pepper in a bowl until combined.

  2. 2

    Place one phyllo sheet on a cutting board. Brush lightly with melted butter.

  3. 3

    Cut the phyllo into 4 strips lengthwise. Place 1 tbsp filling on the lower left corner of each strip.

  4. 4

    Fold the bottom-left corner up and to the right to form a triangle, then keep folding up until you reach the end of the strip.

  5. 5

    Place folded triangles seam-side down on a sheet pan. Brush all pies with remaining butter.

  6. 6

    Bake until golden brown and crispy, 12–14 minutes. Serve warm.

Tools you’ll need

  • sheet pan
  • cutting board
  • small mixing bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Greek recipes →