Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Feta Phyllo Pie (20 Minutes)

Buttery phyllo sheets stuffed with creamy feta, dill, and egg — baked until golden and shatteringly crispy. A Greek-style cheese pie that feels fancy but takes 15 minutes flat.

Total time
20 min
Servings
4
Calories
385
Protein
12g
Crispy Feta Phyllo Pie (20 Minutes)
elegantcasualgreekvegetariancheeseeggscrispycreamy

Ingredients

  • 8 sheets phyllo dough
  • 1.5 cups feta cheese, crumbled
  • 2 whole eggs
  • 3 tbsp fresh dill, chopped
  • ½ cup butter, melted
  • ⅓ cup onion, finely minced

Instructions

  1. 1

    Preheat oven to 400°F. Mix feta, eggs, dill, and minced onion in a bowl until combined.

  2. 2

    Lay one phyllo sheet on a work surface. Brush lightly with melted butter.

  3. 3

    Layer and butter 3 more sheets on top, brushing each lightly between layers.

  4. 4

    Spread half the feta filling in a line across the bottom third of the phyllo stack.

  5. 5

    Roll up tightly from the bottom. Transfer seam-side down to a buttered baking sheet.

  6. 6

    Repeat with remaining 4 phyllo sheets and filling to make a second roll.

  7. 7

    Brush both rolls with remaining butter. Bake until golden brown, 12–14 minutes.

  8. 8

    Cool 2 minutes. Slice into 2-inch pieces. Serve warm.

Tools you’ll need

  • oven
  • large mixing bowl
  • pastry brush
  • baking sheet
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.