Custrd is out on the App Store — Download it free →
Back to recipes

15-Min Crispy Feta Pie

Buttery phyllo sheets layered with crumbled feta, herbs, and a touch of honey — ready in 15 minutes. A salty, flaky Greek classic that tastes like you spent hours in the kitchen.

Total time
15 min
Servings
4
Calories
380
Protein
12g
15-Min Crispy Feta Pie
elegantrusticgreekvegetariancheesecrispyflakycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Mix feta, mint, and pepper in a bowl until evenly combined.

  2. Step 2

    Brush a 9-inch baking dish or sheet pan with melted butter, coating the bottom and sides.

  3. Step 3

    Layer 3 phyllo sheets in the dish, brushing each with butter as you stack.

  4. Step 4

    Spread feta mixture evenly over the phyllo, leaving a thin border on all sides.

  5. Step 5

    Layer remaining 3 phyllo sheets on top, brushing each with butter. Tuck edges under slightly.

  6. Step 6

    Bake 8–10 minutes until golden brown and crispy on top. Drizzle with honey and serve hot.

Tools you’ll need

  • 9-inch baking dish or sheet pan
  • medium bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.