CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Feta Pie in 20 Minutes

Phyllo sheets layered with feta, spinach, and dill, brushed with butter and baked until golden and crunchy. A weeknight Greek classic that feels fancy but takes under 20 minutes.

Total time
20 min
Servings
4
Calories
385
Protein
12g
Crispy Feta Pie in 20 Minutes
comfortelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

  • 8 sheets phyllo sheets, thawed if frozen
  • 1.5 cups feta cheese, crumbled
  • 2 cups fresh spinach, roughly chopped
  • 3 tbsp fresh dill, chopped
  • ½ cup butter, melted
  • 1 whole egg

Instructions

  1. 1

    Preheat oven to 400°F. Mix feta, spinach, dill, and egg in a bowl until combined.

  2. 2

    Brush a 9x13-inch baking sheet with melted butter. Lay one phyllo sheet on top.

  3. 3

    Brush the phyllo with butter, then repeat: layer 3 more sheets, brushing each with butter.

  4. 4

    Spread feta mixture evenly over the phyllo. Top with remaining 4 sheets, brushing each with butter.

  5. 5

    Score the top into squares with a sharp knife, making about 8-12 pieces.

  6. 6

    Bake until golden brown and crispy, 12-15 minutes. Let rest 2 minutes before serving.

Tools you’ll need

  • 9x13-inch baking sheet
  • small mixing bowl
  • pastry brush
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Greek recipes →