CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Feta & Herb Phyllo Pie

Buttery phyllo sheets layered with crumbly feta, fresh dill, and mint—baked until golden and shatteringly crisp. A weeknight Greek classic that tastes like you spent hours but takes 25 minutes.

Total time
25 min
Servings
4
Calories
385
Protein
14g
Crispy Feta & Herb Phyllo Pie
comfortelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

  • 12 oz feta cheese, crumbled
  • ½ box phyllo dough (thawed)
  • 6 tbsp unsalted butter, melted
  • ¼ cup fresh dill, chopped
  • 3 tbsp fresh mint, chopped
  • 2 whole eggs
  • 1 whole lemon (zested + juiced)

Instructions

  1. 1

    Preheat oven to 375°F. Whisk feta, dill, mint, eggs, lemon zest, and lemon juice in a bowl.

  2. 2

    Lay a phyllo sheet on a 9x13-inch baking pan. Brush lightly with melted butter.

  3. 3

    Layer 4 more phyllo sheets over the first, brushing each with butter before adding the next.

  4. 4

    Spread feta mixture evenly over phyllo, then top with 5 more phyllo sheets, brushing each with butter.

  5. 5

    Brush the top sheet generously with butter. Score the pie into squares with a sharp knife.

  6. 6

    Bake until golden brown and crispy, about 18–20 minutes. Cool 3 minutes before serving.

Tools you’ll need

  • 9x13-inch baking pan
  • medium mixing bowl
  • whisk
  • pastry brush
  • sharp knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Greek recipes →