CookSnap is coming soon — Join the waitlist →

Erbazzone: Emilia-Romagna Herb and Cheese Pie

A rustic Italian savory pie filled with tender greens, garlic, and Parmigiano-Reggiano wrapped in buttery pastry. Golden and crispy, it's a complete dinner straight from Emilia-Romagna.

Total time
50 min
Servings
4
Calories
520
Protein
18g
Erbazzone: Emilia-Romagna Herb and Cheese Pie
comfortrusticitalianvegetariancheesecrispytenderflaky

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup butter, cold, cubed
  • 1 tsp salt
  • 5 tbsp ice water
  • 1.5 lb mixed greens (Swiss chard, spinach, beet greens)
  • 2 cloves garlic, minced
  • 1 cup Parmigiano-Reggiano, grated

Instructions

  1. 1

    Pulse flour, cold butter, and salt in a food processor until mixture resembles coarse sand.

  2. 2

    Add ice water 1 tbsp at a time, pulsing until dough just comes together.

  3. 3

    Flatten dough into a disk, wrap in plastic, and chill 20 minutes.

  4. 4

    Slice greens into 1-inch ribbons, discarding tough stems. Roughly chop any very large pieces.

  5. 5

    Heat 2 tbsp olive oil in a large skillet over medium-high. Add garlic and cook 30 seconds.

  6. 6

    Add greens in batches, stirring and pressing down until completely wilted, ~4 minutes total.

  7. 7

    Transfer to a colander and squeeze out excess liquid. Cool slightly, then stir in Parmigiano.

  8. 8

    Preheat oven to 400°F. Divide dough in half. Roll one half to fit a 10-inch pie dish.

  9. 9

    Spread cooled greens filling evenly over dough. Top with second dough round, seal edges.

  10. 10

    Cut small slits in top crust. Brush with 1 tbsp melted butter.

  11. 11

    Bake until golden brown on top and edges, ~20 minutes. Cool 5 minutes before slicing.

Tools you’ll need

  • food processor
  • plastic wrap
  • large skillet
  • colander
  • 10-inch pie dish
  • rolling pin
  • small pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.