CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Torta Salata

A savory Italian vegetable tart with tender leeks, ricotta, and herbs baked in a flaky pastry crust. Rich, rustic, and elegant enough for dinner.

Total time
50 min
Servings
4
Calories
485
Protein
18g
Torta Salata
elegantrusticitalianvegetariancheeseflakycreamytender

Ingredients

  • 1.5 cups all-purpose flour
  • 6 tbsp cold unsalted butter, cubed
  • ½ tsp salt
  • ¼ cup ice water
  • 1.5 lbs leeks (white and light green parts), sliced into thin half-moons
  • 1 cup ricotta
  • ½ cup whole milk
  • 3 large eggs
  • ½ cup Pecorino Romano, grated
  • 3 tbsp fresh flat-leaf parsley, chopped
  • 1 tsp fresh thyme leaves
  • 1 pinch black pepper to taste
  • 2 tbsp olive oil

Instructions

  1. 1

    Mix flour and salt in a bowl. Add cold butter and rub with fingertips until breadcrumb-like.

  2. 2

    Add ice water 1 tbsp at a time, tossing gently, until dough just holds together.

  3. 3

    Flatten dough into a disk, wrap in plastic, and chill for 30 minutes.

  4. 4

    Heat olive oil in a large skillet over medium. Add leeks and cook, stirring, until soft and golden, ~12 minutes.

  5. 5

    Let leeks cool for 5 minutes. Transfer to a large bowl.

  6. 6

    Whisk ricotta, milk, eggs, Pecorino, parsley, thyme, and pepper into the leeks until smooth.

  7. 7

    Preheat oven to 375°F. Roll dough on parchment to fit a 9-inch tart pan or pie dish.

  8. 8

    Transfer dough to the pan, trim edges, and prick the bottom with a fork.

  9. 9

    Pour filling into the crust and smooth the top.

  10. 10

    Bake until the surface is golden and a knife inserted in the center comes out clean, ~25 minutes.

  11. 11

    Let rest 5 minutes before slicing. Serve warm or at room temperature.

Tools you’ll need

  • mixing bowl
  • large skillet
  • 9-inch tart pan or pie dish
  • rolling pin
  • parchment paper
  • pastry fork or whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.