Custrd is out on the App Store — Download it free →
Back to recipes

Eel Sushi Roll

A quick homemade sushi roll filled with savory grilled eel, creamy mayo, and a hint of wasabi, wrapped in nori and seasoned rice.

Total time
20 min
Servings
4
Calories
350
Protein
15g
Eel Sushi Roll
comfortingjapanesedairy-freefishchewycreamyweeknightsushi

Ingredients

  • 2 cups sushi rice
  • 4 sheets nori sheets
  • 8 oz grilled eel (unagi)
  • 3 tbsp mayonnaise
  • 1 tsp wasabi paste
  • 1 tbsp sesame seeds

Instructions

  1. 1

    Cook 2 cups sushi rice according to package directions, then let cool until warm but not hot, about 10 minutes.

  2. 2

    Mix 3 tbsp mayonnaise with 1 tsp wasabi paste in a small bowl; set aside.

  3. 3

    Place 1 nori sheet on a bamboo mat, spread 1/2 cup rice evenly over it, leaving a 1 inch strip at the top edge.

  4. 4

    Lay 2 oz eel across the rice, then spread 1 tbsp of the wasabi mayo over the eel.

  5. 5

    Roll tightly from the bottom, moisten the top edge with water to seal, then slice into 6 pieces and sprinkle with 1 tbsp sesame seeds.

Tools you’ll need

  • bamboo sushi mat
  • sharp knife
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.