CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Dutch Beef Stamppot Hutspot

Mashed potatoes, carrots, and onions layered with browned ground beef and topped with a crispy fried onion crown. A weeknight version of the Dutch classic.

Total time
28 min
Servings
4
Calories
542
Protein
24g
Dutch Beef Stamppot Hutspot
comfortheartydutchbeefcreamytendercrispyweeknight

Ingredients

  • 1.5 lb potatoes, peeled and cut into 1-inch chunks
  • 3 medium carrots, cut into 1-inch chunks
  • 2 medium yellow onions, divided
  • ¾ lb ground beef
  • 3 tbsp butter
  • ½ cup beef broth
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Boil potatoes and carrots in salted water until fork-tender, about 12 minutes. Drain and set aside.

  2. 2

    While potatoes cook, chop 1.5 onions. Heat oil in a large skillet over medium-high and brown ground beef, breaking it with a spoon, until no pink remains, ~6 minutes.

  3. 3

    Add chopped onions and beef broth to the beef. Simmer for 2 minutes until onions soften slightly.

  4. 4

    Mash hot potatoes and carrots with butter and a pinch of salt until creamy but still textured. Fold into the beef mixture gently.

  5. 5

    Slice remaining half onion into thin rings. Fry in a small skillet with oil over medium-high until golden and crispy, ~4 minutes.

  6. 6

    Transfer stamppot to a serving bowl. Top with crispy onions and parsley. Serve hot.

Tools you’ll need

  • large pot
  • large skillet (12-inch)
  • small skillet (8-inch)
  • wooden spoon
  • colander
  • potato masher

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.