CookSnap is coming soon — Join the waitlist →

Crispy Yangnyeom Chicken Wings

Sheet-pan Korean wings with a sticky-spicy gochujang glaze, sesame seeds, and scallions. Broil for crispy skin, toss in the sauce, done in 25 minutes.

Total time
25 min
Servings
2
Calories
485
Protein
42g
Crispy Yangnyeom Chicken Wings
satisfyingcasualkoreanchickencrispytenderweeknightgame-day

Ingredients

  • 2 lbs chicken wings
  • 3 tbsp gochujang (Korean red chili paste)
  • 2 tbsp honey
  • 2 tbsp soy sauce
  • 1 tbsp rice vinegar
  • 3 cloves minced garlic
  • 2 tbsp sesame seeds (white or black)
  • 2 stalks scallions, sliced thin

Instructions

  1. 1

    Pat wings dry with paper towels. Toss with salt, pepper, and a light drizzle of oil on a sheet pan.

  2. 2

    Broil 5 inches from heat for 12–14 minutes, shaking pan halfway through, until skin is crispy and golden.

  3. 3

    While wings broil, whisk gochujang, honey, soy sauce, vinegar, and garlic in a small bowl until smooth.

  4. 4

    Remove wings from broiler. Pour glaze over and toss until evenly coated.

  5. 5

    Return to broiler for 2–3 minutes until glaze is sticky and caramelized, watching to avoid burning.

  6. 6

    Top with sesame seeds and scallions. Serve hot with extra napkins.

Tools you’ll need

  • sheet pan (18×13 inch)
  • small mixing bowl
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.