Crispy Tortilla Pizza
Flour tortillas become a thin, crackly crust in minutes. Top with pizza sauce and melted mozzarella, then broil until bubbly and golden.
- Total time
- 10 min
- Servings
- 2
- Calories
- 320
- Protein
- 14g
quickcasualamericanvegetariancrispymeltyweeknightpizza
Ingredients
- 2 whole flour tortillas
- 4 tbsp pizza sauce
- 1 cup mozzarella cheese, shredded
Instructions
- 1
Place tortillas on a baking sheet and broil 2 minutes until lightly crisped.
- 2
Spread 2 tbsp pizza sauce on each tortilla, leaving a thin edge.
- 3
Top each with half the mozzarella, spread evenly.
- 4
Broil 2–3 minutes until cheese melts and edges bubble.
- 5
Slice and serve hot.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
