CookSnap is coming soon — Join the waitlist →

Crispy Pretzel Sticks with Whole-Grain Mustard

German laugenstange reimagined as a fast, chewy pretzel-style breadstick you can make in one bowl and bake on a sheet pan. Boiled in baking soda, brushed with butter, and finished with coarse salt—ready in 18 minutes.

Total time
18 min
Servings
4
Calories
208
Protein
6g
Crispy Pretzel Sticks with Whole-Grain Mustard
casualsimplegermanvegetarianchewycrispyweeknightsnack

Ingredients

  • 2 cups all-purpose flour
  • ¾ cup warm water
  • 1.5 tsp instant yeast
  • 2 tbsp baking soda (for boiling water)
  • 2 tbsp butter, melted
  • 1 tbsp coarse pretzel salt or sea salt

Instructions

  1. 1

    Mix 2 cups flour, 0.75 cup warm water, 1.5 tsp yeast, and 1 tsp salt in a bowl until shaggy.

  2. 2

    Knead by hand 3 minutes until smooth, then divide into 8 equal pieces and roll each into a 10-inch rope.

  3. 3

    Bring a pot of water to a boil, stir in 2 tbsp baking soda, then dunk each rope 20 seconds per side.

  4. 4

    Place boiled sticks on a sheet pan lined with parchment, brush with melted butter, sprinkle with coarse salt.

  5. 5

    Bake at 425°F for 8–10 minutes until deep golden and crispy on edges.

  6. 6

    Cool 2 minutes, then serve warm with mustard or as-is.

Tools you’ll need

  • large mixing bowl
  • rolling surface
  • large pot
  • sheet pan
  • parchment paper
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.