CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Pretzel Sticks with Hot Mustard

Golden, salty pretzel sticks with a tender crumb inside, baked until edges curl. Serve warm with sharp mustard for dipping—authentic German laugen flavor in 20 minutes, no yeast required.

Total time
20 min
Servings
4
Calories
180
Protein
5g
Crispy Pretzel Sticks with Hot Mustard
simplecasualgermanvegetariancrispytenderweeknightsnack

Ingredients

  • 2 cups all-purpose flour
  • 1 tsp baking soda
  • ¾ cup water
  • 1 tbsp coarse sea salt (for topping)
  • ½ cup whole-grain mustard
  • ½ tsp caraway seeds (optional)

Instructions

  1. 1

    Mix flour and baking soda in a bowl, then add water and stir until a shaggy dough forms.

  2. 2

    Knead on a counter for 2 minutes until smooth. Divide into 12 pieces and roll each into a 6-inch stick.

  3. 3

    Dissolve 1 tbsp baking soda in 1 cup boiling water. Dip each stick 10 seconds per side until edges look slightly translucent.

  4. 4

    Lay sticks on a parchment-lined sheet pan. Sprinkle with coarse salt and caraway seeds if using.

  5. 5

    Bake at 425°F until deep golden brown and edges feel crisp, 10–12 minutes.

  6. 6

    Cool 2 minutes on the pan. Serve warm with whole-grain mustard for dipping.

Tools you’ll need

  • large mixing bowl
  • measuring cups and spoons
  • sheet pan
  • parchment paper
  • shallow dipping bowl (for baking soda bath)
  • oven
  • kitchen counter or cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.