CookSnap is coming soon — Join the waitlist →

Crispy Grissini Torinesi

Snappy Italian breadsticks with a salty crust and tender crumb, ready in under 25 minutes. No yeast waiting—just olive oil, flour, and a hot oven.

Total time
22 min
Servings
4
Calories
285
Protein
7g
Crispy Grissini Torinesi
simplecasualitalianvegancrispytenderweeknightsnack

Ingredients

  • 2 cups all-purpose flour
  • ¼ cup olive oil
  • ¾ cup water, warm
  • 1 tsp salt
  • 1 tsp coarse sea salt (for topping)
  • 1 tbsp sesame seeds (optional)

Instructions

  1. 1

    Mix flour, salt, and warm water in a bowl until a shaggy dough forms, then knead for 2 minutes until smooth.

  2. 2

    Add olive oil to the dough and knead for 1 minute until fully incorporated and dough feels silky.

  3. 3

    Divide dough into 12 pieces. Roll each into a thin rope about 10 inches long.

  4. 4

    Place ropes on a parchment-lined sheet pan, brush lightly with olive oil, and sprinkle with coarse sea salt and sesame seeds.

  5. 5

    Bake at 425°F for 12–14 minutes until golden brown and crispy throughout.

  6. 6

    Cool on the sheet pan for 2 minutes, then serve.

Tools you’ll need

  • mixing bowl
  • sheet pan
  • parchment paper
  • oven
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.