CookSnap is coming soon — Join the waitlist →

Crispy Jalebi — Golden Fried Spirals

Tender, syrup-soaked fried spirals with a shatteringly crispy exterior and bright orange hue. A quick Indian sweet that's pure TikTok gold — watch the batter hit the oil and form those perfect loops.

Total time
25 min
Servings
2
Calories
385
Protein
3g
Crispy Jalebi — Golden Fried Spirals
indulgentcelebratoryindianvegetariancrispychewydessertweeknight

Ingredients

  • 1 cup all-purpose flour
  • ½ cup plain yogurt
  • ¼ tsp turmeric powder
  • 2 drops orange food coloring (optional but traditional)
  • 1 cup granulated sugar
  • 2 cups neutral oil for deep frying

Instructions

  1. 1

    Whisk flour, yogurt, turmeric, and orange coloring (if using) until you have a thin, smooth batter with no lumps.

  2. 2

    In a saucepan, combine 1 cup sugar with 1 cup water. Bring to a boil, then lower heat and simmer 5 minutes until syrupy.

  3. 3

    Heat 2 cups oil in a deep pan or wok to 350°F. Test by dropping a tiny batter dollop — it should sizzle and float immediately.

  4. 4

    Fill a piping bag with batter. Squeeze thin spiral coils directly into hot oil, creating connected loops about 3 inches wide.

  5. 5

    Fry 90 seconds per side until deep golden and crispy. Transfer to paper towels, then immediately dunk into warm syrup.

  6. 6

    Serve warm or at room temperature. The jalebi should be crispy outside, chewy and syrup-soaked inside.

Tools you’ll need

  • large deep pan or wok
  • candy thermometer
  • piping bag with medium round tip
  • paper towels
  • saucepan
  • whisk
  • slotted spoon or spider strainer

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.