CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Honey Torrijas

Spanish French toast soaked in sweet wine syrup, fried golden, then drizzled with honey. Takes 15 minutes and tastes like dessert dinner.

Total time
15 min
Servings
2
Calories
385
Protein
9g
Crispy Honey Torrijas
comfortindulgentspanishvegetarianeggscrispytenderweeknight

Ingredients

  • 4 slices thick-cut bread (brioche or day-old), sliced 0.75-inch thick
  • ½ cup dry white wine or sherry
  • 3 tbsp granulated sugar
  • 1 piece cinnamon stick
  • 2 whole large eggs
  • 3 tbsp honey

Instructions

  1. 1

    Heat wine, sugar, cinnamon, and 0.5 cup water in a shallow bowl over medium until steam rises, about 2 minutes.

  2. 2

    Soak each bread slice in the warm wine syrup for 5 seconds per side, then lay on a plate.

  3. 3

    Crack eggs into another bowl and whisk until no whites remain, about 30 seconds.

  4. 4

    Heat 2 tbsp oil in a 10-inch skillet over medium-high until shimmer appears, 60 seconds.

  5. 5

    Coat soaked bread in beaten egg, place in skillet, and pan-fry 2 minutes per side until golden brown.

  6. 6

    Transfer to plate and drizzle generously with honey while still warm. Serve immediately.

Tools you’ll need

  • shallow bowl
  • 10-inch skillet
  • plate
  • spatula
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Spanish recipes →