CookSnap is coming soon — Join the waitlist →

Crispy Ghee Roast Dosa

Golden, lacy dosa crisped in ghee with roasted spices and finished with caramelized onions. A restaurant-style South Indian breakfast or dinner that tastes like it took hours but cooks in under 20 minutes.

Total time
18 min
Servings
2
Calories
380
Protein
6g
Crispy Ghee Roast Dosa
elegantsatisfyingindianvegetariangluten-freevegetariancrispycreamy

Ingredients

  • 1.5 cups store-bought dosa batter (or dosa mix)
  • 4 tbsp ghee, divided
  • 1 medium yellow onion, thinly sliced
  • ½ tsp black mustard seeds
  • 8 leaves curry leaves, fresh
  • ¼ tsp red chili powder
  • 3 tbsp fresh cilantro, chopped

Instructions

  1. 1

    Heat 1 tbsp ghee in a large skillet over medium-high until it shimmers and smells nutty, about 1 minute.

  2. 2

    Add sliced onion and cook, stirring often, until edges brown and char, 5–6 minutes. Scrape onto a plate.

  3. 3

    Pour 0.5 cup batter into the center of the skillet and spread in a thin circular motion until the crepe is lacy and edges are translucent.

  4. 4

    Drizzle 0.75 tbsp ghee around the edges, then scatter mustard seeds, curry leaves, and a pinch of red chili powder on top.

  5. 5

    Cook until the bottom is golden and crispy, 2–3 minutes, then flip carefully and cook the other side for 1 minute until light brown.

  6. 6

    Slide onto a plate, top with roasted onions and cilantro, then repeat with remaining batter and ghee. Serve hot.

Tools you’ll need

  • 12-inch non-stick skillet or cast iron
  • spatula or metal crepe spreader
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.