CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Fish & Mushy Peas

Frozen fish fillets crisped in a hot skillet, paired with buttery smashed peas and crispy oven chips. British seaside comfort in 12 minutes.

Total time
12 min
Servings
2
Calories
485
Protein
38g
Crispy Fish & Mushy Peas
comfortcasualbritishfishcrispycreamytenderweeknight

Ingredients

  • 2 fillets (about 150g each) frozen fish fillets (cod or pollock)
  • 300 g frozen oven chips
  • 200 g frozen peas
  • 2 tbsp butter
  • 1 tbsp malt vinegar
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Start the oven chips according to package directions (usually 400°F, 20 min). Set a timer.

  2. 2

    Boil the peas in salted water for 3 minutes until tender. Drain and return to the pot.

  3. 3

    Mash the peas with butter, salt, and pepper until creamy. Stir in malt vinegar. Set aside and keep warm.

  4. 4

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 1 minute.

  5. 5

    Place fish fillets in the pan skin-side up. Pan-fry 4 minutes without moving until the bottom is golden and crispy.

  6. 6

    Flip the fillets and cook 2 minutes until the flesh is opaque and flakes easily. Season with salt and pepper.

  7. 7

    Plate the mushy peas, top with crispy fish, and serve with hot chips on the side.

Tools you’ll need

  • large skillet (10–12 inch)
  • small saucepan
  • wooden spoon or masher
  • slotted spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.