CookSnap is coming soon — Join the waitlist →
Back to recipes

British Fish Finger Sandwich

Crispy, golden fish fingers nestled between buttered bread with tartar sauce and a squeeze of lemon. A quick, nostalgic British classic ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
432
Protein
16g
British Fish Finger Sandwich
casualcomfortbritishfishcrispytenderweeknightlunch

Ingredients

  • 8 pieces frozen fish fingers
  • 2 tbsp butter
  • 4 slices white bread, sliced
  • 3 tbsp tartar sauce
  • ½ whole lemon
  • 1 to taste salt and pepper

Instructions

  1. 1

    Heat a non-stick skillet over medium-high. Once hot, add fish fingers and cook 5–6 minutes, shaking pan occasionally, until golden and crispy on all sides.

  2. 2

    While fish cooks, butter one side of each bread slice generously.

  3. 3

    Spread tartar sauce on the unbuttered side of two bread slices.

  4. 4

    Divide cooked fish fingers between the two sauced bread slices. Season with salt and pepper.

  5. 5

    Squeeze lemon juice over fish. Top with remaining bread slices, buttered side facing outward.

  6. 6

    Serve immediately while fish is still hot and crispy.

Tools you’ll need

  • 12-inch non-stick skillet
  • butter knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.