CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Arepa Rellena with Shredded Chicken & Cheese

Golden-fried corn patties stuffed with shredded chicken, melted cheese, and a bright lime crema. Ready in 25 minutes—the TikTok-friendly version of Colombia's iconic street snack.

Total time
25 min
Servings
2
Calories
580
Protein
24g
Crispy Arepa Rellena with Shredded Chicken & Cheese
casualcomfortcolombianchickencrispycreamytenderweeknight

Ingredients

  • 1 cup pre-cooked shredded chicken
  • ¾ cup white cheddar or mozzarella, shredded
  • 1.5 cups arepa flour (corn flour for arepas)
  • 1 cup warm water
  • 1 whole lime (juiced)
  • ½ cup sour cream or crema
  • 2 cups neutral oil for frying

Instructions

  1. 1

    Mix arepa flour, warm water, and a pinch of salt until a soft dough forms, about 1 minute.

  2. 2

    Stir lime juice and a pinch of salt into sour cream; set the crema aside.

  3. 3

    Form 4 golf-ball-sized dough balls and flatten to thick discs. Make a pocket in each and fill with chicken and cheese.

  4. 4

    Heat oil in a deep skillet over medium-high until shimmering. Fry arepas 3 minutes per side until deep golden.

  5. 5

    Transfer arepas to a paper towel–lined plate. Serve hot with lime crema on the side.

Tools you’ll need

  • large mixing bowl
  • deep skillet (10-inch minimum)
  • kitchen scale or measuring cups
  • slotted spoon
  • paper towels
  • small bowl for crema

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.