CookSnap is coming soon — Join the waitlist →

20-Min Crispy Chicken Ouzi

Shredded rotisserie chicken wrapped in crispy phyllo with warm spices and a hint of lemon. Baked until golden, it's the TikTok-easy version of Syria's beloved pastry.

Total time
18 min
Servings
2
Calories
485
Protein
34g
20-Min Crispy Chicken Ouzi
comfortelegantsyrianmiddle-easternchickencrispytenderweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 6 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • ½ tsp ground cinnamon
  • 1 whole lemon (zested + juiced)
  • ¼ cup pine nuts, toasted

Instructions

  1. 1

    Preheat oven to 400°F. Mix shredded chicken with lemon zest, lemon juice, cinnamon, salt, and pepper until fragrant.

  2. 2

    Brush one phyllo sheet with melted butter. Layer 2 more sheets on top, brushing each with butter.

  3. 3

    Spoon half the chicken mixture and half the pine nuts along one long edge, leaving a 2-inch border.

  4. 4

    Roll tightly from the filling side, tucking in the sides as you go. Brush the outside generously with butter.

  5. 5

    Repeat steps 2–4 with remaining phyllo, chicken, and pine nuts. Place both rolls seam-side down on a sheet pan.

  6. 6

    Bake for 10–12 minutes until deep golden brown and edges curl slightly. Slice and serve hot.

Tools you’ll need

  • sheet pan
  • small bowl
  • pastry brush
  • oven (400°F)
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.