CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Cheese Phyllo Triangles

Golden, flaky phyllo wrapped around salty feta and ricotta, baked until edges curl and crackle. A 25-minute Greek appetizer that tastes like you spent hours in the kitchen.

Total time
25 min
Servings
4
Calories
280
Protein
9g
Crispy Cheese Phyllo Triangles
crispyelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

  • 1 cup feta cheese, crumbled
  • ½ cup ricotta cheese
  • 2 tbsp fresh dill or parsley, chopped
  • 8 sheets phyllo sheets, thawed
  • 4 tbsp butter, melted
  • ¼ tsp black pepper

Instructions

  1. 1

    Mix feta, ricotta, dill, and black pepper in a bowl until combined.

  2. 2

    Preheat oven to 400°F. Line a baking sheet with parchment paper.

  3. 3

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  4. 4

    Spoon 2 tbsp cheese filling near the bottom-left corner. Fold the phyllo into a triangle, tucking and folding as you go.

  5. 5

    Place triangle on the baking sheet, seam-side down. Repeat with remaining phyllo sheets and filling.

  6. 6

    Brush each triangle with butter. Bake for 12–15 minutes until golden brown and edges curl.

Tools you’ll need

  • mixing bowl
  • cutting board
  • baking sheet
  • parchment paper
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Greek recipes →