CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Crispy Bun Xao

Crispy chow mein noodles tossed with shrimp, chicken, and a tangy-sweet Vietnamese sauce. High heat, one skillet, ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
32g
20-Min Crispy Bun Xao
quicksatisfyingvietnameseshrimpchickencrispytenderweeknight

Ingredients

  • 1 can (5 oz) crispy chow mein noodles (canned, drained)
  • ⅓ lb shrimp, peeled and deveined
  • 1 cup rotisserie chicken, shredded
  • 2 tbsp fish sauce
  • 1 whole lime (juiced)
  • 1 tbsp granulated sugar
  • 3 whole scallions, sliced thin (green + white parts)

Instructions

  1. 1

    Whisk fish sauce, lime juice, sugar, and 2 tbsp water in a small bowl until sugar dissolves. Set aside.

  2. 2

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Add shrimp and cook without stirring for 90 seconds, then flip and cook 60 seconds more until opaque throughout.

  4. 4

    Add chicken and crispy noodles, tossing constantly for 1 minute until heated through.

  5. 5

    Pour sauce over the pan and toss everything together for 30 seconds until glossy and combined.

  6. 6

    Remove from heat, scatter scallions on top, and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • small mixing bowl
  • whisk
  • tongs or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →