CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Buffalo Chicken Quesadilla

Shredded rotisserie chicken tossed with buffalo sauce, melted between tortillas with cheddar, then pan-fried until the outside crisps and the cheese oozes. Serve with mayo for dipping and pickled vegetables on the side.

Total time
12 min
Servings
2
Calories
520
Protein
34g
Crispy Buffalo Chicken Quesadilla
comfortquickmexicanchickencrispymeltytenderweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • ½ cup buffalo sauce
  • 4 count flour tortillas
  • 1 cup cheddar cheese, shredded

Instructions

  1. 1

    Toss shredded chicken with buffalo sauce until fully coated.

  2. 2

    Lay one tortilla flat, sprinkle half the cheese on it, then top with buffalo chicken.

  3. 3

    Add remaining cheese, then place second tortilla on top and press gently.

  4. 4

    Heat a skillet over medium-high until a water droplet sizzles on contact, ~60 seconds.

  5. 5

    Slide quesadilla into the skillet and cook 3 minutes until golden and crispy on the bottom.

  6. 6

    Flip carefully and cook 2 minutes more until the second side is golden and cheese melts through.

Tools you’ll need

  • medium bowl
  • 10-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.