CookSnap is coming soon — Join the waitlist →

Skillet Chicken Fajita Quesadilla

Rotisserie chicken, peppers, and cheese melted in a tortilla skillet-style. Charred, gooey, and ready in under 15 minutes—no oven needed.

Total time
12 min
Servings
2
Calories
520
Protein
28g
Skillet Chicken Fajita Quesadilla
casualsatisfyingtex-mexchickencrispymeltytenderweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 1.5 cups bell peppers (red, yellow, or orange), diced
  • 4 pieces flour tortillas (8-inch)
  • 1 cup shredded cheese (cheddar or Oaxaca)
  • ¾ cup tomatoes, diced
  • 2 tbsp fajita seasoning or cumin, chili powder, garlic powder mixed

Instructions

  1. 1

    Heat oil in a 10-inch skillet over medium-high. Add diced peppers and cook, stirring, for 3 minutes until softened.

  2. 2

    Stir in shredded chicken, diced tomatoes, and fajita seasoning. Cook 2 minutes until fragrant and warmed through.

  3. 3

    Push filling to one side. Lay a tortilla flat in the empty space and let it warm 30 seconds.

  4. 4

    Sprinkle cheese over the tortilla, then slide it onto a plate and fold in half while still warm.

  5. 5

    Repeat with remaining tortillas and filling until all four quesadillas are made.

  6. 6

    Wipe skillet clean. Return it to medium-high and sear folded quesadillas 1 minute per side until golden and crispy.

Tools you’ll need

  • 10-inch skillet
  • wooden spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.