CookSnap is coming soon — Join the waitlist →

Quesadillas de Tinga

Crispy tortillas stuffed with smoky shredded chicken in a tangy chipotle tomato sauce, topped with melted cheese and pickled jalapeños. A restaurant-quality handheld that comes together in under 20 minutes.

Total time
20 min
Servings
2
Calories
520
Protein
38g
Quesadillas de Tinga
casualsatisfyingmexicanchickencrispymeltytenderweeknight

Ingredients

  • 1.5 cups shredded cooked chicken
  • ¾ cup canned diced tomatoes
  • 1 whole chipotle pepper in adobo sauce
  • 4 whole large flour tortillas
  • 1.5 cups shredded oaxaca or mozzarella cheese
  • ¼ cup pickled jalapeños
  • ½ whole onion, diced
  • 2 tablespoons butter or oil for cooking

Instructions

  1. 1

    Heat 1 tbsp butter in a large skillet over medium-high heat until it foams, ~1 minute.

  2. 2

    Add diced onion and cook, stirring, until softened and lightly golden, ~3 minutes.

  3. 3

    Add shredded chicken, canned tomatoes, and 1 chipotle pepper (minced). Stir to combine.

  4. 4

    Simmer for 3-4 minutes, breaking up chicken, until sauce thickens slightly and coats chicken.

  5. 5

    Season with salt and pepper to taste. Transfer to a bowl and wipe out the skillet.

  6. 6

    Heat remaining 1 tbsp butter in the skillet over medium-high until it foams.

  7. 7

    Place one tortilla in the skillet. Add 1/4 of the chicken tinga, 1/4 of the cheese, and pickled jalapeños to half.

  8. 8

    Fold tortilla in half. Cook without moving until the bottom is golden and crispy, ~2 minutes.

  9. 9

    Flip and cook the other side until golden and cheese melts, ~90 seconds.

  10. 10

    Transfer to a plate. Repeat with remaining tortillas, tinga, cheese, and jalapeños.

  11. 11

    Serve hot with sour cream and extra jalapeños on the side.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • measuring cups and spoons
  • knife and cutting board
  • two shallow bowls or plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.