CookSnap is coming soon — Join the waitlist →

Crispy Chicken Quesadilla

Pan-fried flour tortillas stuffed with seasoned shredded chicken, melted cheese, and sautéed peppers. Golden, crispy, and ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
32g
Crispy Chicken Quesadilla
comfortquickmexicanchickencrispymeltytenderweeknight

Ingredients

  • 1.5 cups cooked shredded chicken
  • 4 count flour tortillas (8-inch)
  • 1 cup shredded cheddar or Oaxaca cheese
  • 1 count bell pepper (any color), thinly sliced
  • 3 tbsp olive oil
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, about 60 seconds.

  2. 2

    Add sliced peppers. Sauté, stirring occasionally, until edges soften and edges char slightly, 4–5 minutes.

  3. 3

    Stir in chicken and season with salt and pepper. Cook until warmed through, about 1 minute.

  4. 4

    Transfer filling to a plate. Wipe out the skillet with a paper towel.

  5. 5

    Lay one tortilla flat. Spread half the cheese on one half, then top with half the filling.

  6. 6

    Fold tortilla in half. Repeat with second tortilla, filling, and remaining cheese.

  7. 7

    Heat 1 tbsp oil in the skillet over medium-high until shimmering.

  8. 8

    Place one quesadilla in the pan. Cook without moving until the underside is golden and crispy, 2–3 minutes.

  9. 9

    Flip and cook the other side until golden, 1–2 minutes. Transfer to a cutting board.

  10. 10

    Repeat with remaining 1 tbsp oil and second quesadilla.

  11. 11

    Cut each quesadilla into wedges. Serve immediately.

Tools you’ll need

  • 12-inch skillet or larger
  • cutting board
  • chef's knife
  • paper towels
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.