CookSnap is coming soon — Join the waitlist →
Back to recipes

Crispy Beef Lahmacun with Garlic Sauce

Turkish-style meat flatbread with a paper-thin, golden-crispy crust topped with spiced ground beef and fresh garnishes. Build-your-own wraps with garlicky yogurt sauce, lemon, and chili heat.

Total time
18 min
Servings
2
Calories
385
Protein
22g
Crispy Beef Lahmacun with Garlic Sauce
casualsatisfyingmiddle-easternbeefcrispytenderweeknightdinner

Ingredients

  • 2 pieces naan or pita bread (2 pieces)
  • 6 oz ground beef
  • ½ cup Greek yogurt mixed with 1 minced garlic clove
  • ¾ cup diced tomatoes
  • ¼ cup sliced red onion
  • 1 cup fresh spinach

Instructions

  1. 1

    Heat a skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, ~4 minutes. Season with salt, pepper, and a pinch of chili flakes.

  2. 2

    Toast naan directly over a gas flame or under a broiler until puffed and charred in spots, ~2 minutes per side. Work quickly so it stays supple.

  3. 3

    Lay naan flat. Spread garlic yogurt sauce over the surface, leaving a 0.5-inch border.

  4. 4

    Top with cooked beef, diced tomatoes, sliced red onion, and fresh spinach. Squeeze lemon over everything.

  5. 5

    Fold or roll loosely and serve immediately. The warmth of the meat will gently wilt the spinach.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • gas stove or oven broiler

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Middle Eastern recipes →