CookSnap is coming soon — Join the waitlist →
Back to recipes

Turkish Lahmacun with Crispy Edges

Thin, blistered Turkish flatbread topped with spiced ground beef, finished with lemon and fresh salad. Ready in under 20 minutes with store-bought naan as the shortcut.

Total time
18 min
Servings
2
Calories
420
Protein
22g
Turkish Lahmacun with Crispy Edges
casualsatisfyingmiddle-easternbeefcrispytenderweeknightdinner

Ingredients

  • ½ lb ground beef
  • 2 pieces naan or pita bread
  • ¼ cup red onion, minced
  • 2 tbsp tomato paste
  • 1 tsp cumin and red pepper flakes, mixed
  • 1 whole fresh lemon
  • 1 cup fresh salad greens or arugula

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. 2

    Add ground beef and minced onion, breaking up the meat with a spoon until no pink remains, 4–5 minutes.

  3. 3

    Stir in tomato paste, cumin, and red pepper flakes. Cook until fragrant, 90 seconds.

  4. 4

    Warm naan directly over the stovetop flame or in a dry skillet until soft and pliable, 30 seconds per side.

  5. 5

    Spread beef mixture onto each piece of naan, leaving a 0.5-inch border. Sear in the skillet until edges crisp, 2 minutes per side.

  6. 6

    Serve with fresh salad, lemon wedges, and ayran (or yogurt-based drink) on the side.

Tools you’ll need

  • large skillet (12-inch cast iron or stainless steel)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.