CookSnap is coming soon — Join the waitlist →

Crispy Beef Croquette Sandwich

Frozen beef croquettes crisped in a skillet, nestled in soft bread with mustard and pickles. The Dutch classic reimagined as a 15-minute weeknight dinner.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Crispy Beef Croquette Sandwich
comfortcasualdutchbeefcrispytenderweeknightsandwich

Ingredients

  • 4 count frozen beef croquettes
  • 2 count soft white bread rolls or brioche buns
  • 2 tbsp whole-grain mustard
  • ⅓ cup dill pickle slices
  • 1 tbsp butter
  • 2 tbsp neutral cooking oil
  • ¼ tsp salt and pepper

Instructions

  1. 1

    Heat oil in a large skillet over medium-high until it shimmers, about 1 minute.

  2. 2

    Place frozen croquettes in the skillet and cook without moving for 3 minutes until golden brown on one side.

  3. 3

    Flip the croquettes and cook another 3 minutes until crispy and heated through. Season lightly with salt and pepper.

  4. 4

    Butter and lightly toast the bread rolls in the same skillet, cut-side down, for 1 minute until golden.

  5. 5

    Spread mustard on the bottom halves, add 2 croquettes per sandwich, then top with pickles and the top half.

  6. 6

    Serve immediately while croquettes are still crispy.

Tools you’ll need

  • large skillet or frying pan
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.