Custrd is out on the App Store — Download it free →
Back to recipes

Creamy Cajun Crawfish Mac

Tender pasta tossed with a spiced cheese sauce, loaded crawfish, and a hit of hot sauce for that Cajun kick. Ready in under 20 minutes, straight from one skillet to the plate.

Total time
18 min
Servings
4
Calories
720
Protein
38g
Creamy Cajun Crawfish Mac
comfortsatisfyingcajunshrimpcreamytenderweeknightdinner

Ingredients

  • 12 oz elbow pasta
  • 1 lb crawfish tail meat, drained
  • 2 cups sharp cheddar cheese, shredded
  • 3 tbsp butter
  • 1 cup heavy cream
  • 1.5 tbsp hot sauce (Frank's RedHot or similar)

Instructions

  1. 1

    Boil pasta in salted water until al dente, about 8 minutes. Reserve 1 cup pasta water, then drain.

  2. 2

    In the same pot, melt butter over medium heat. Add crawfish and stir until fragrant, about 1 minute.

  3. 3

    Pour in cream and hot sauce. Stir until it simmers, then reduce heat to low.

  4. 4

    Add cheddar slowly, stirring constantly until melted and smooth, about 2 minutes.

  5. 5

    Stir in pasta. If sauce is too thick, add reserved pasta water a splash at a time.

  6. 6

    Taste and adjust with salt, pepper, and extra hot sauce. Serve hot.

Tools you’ll need

  • large pot
  • wooden spoon
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.