Custrd is out on the App Store — Download it free →
Back to recipes

Spicy Crawfish Mac and Cheese

Creamy one-pan pasta loaded with crawfish, sharp cheddar, and a kick of Cajun spice. Ready in 18 minutes—no bake required.

Total time
18 min
Servings
4
Calories
658
Protein
42g
Spicy Crawfish Mac and Cheese
comfortindulgentcajunshrimpcreamytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, about 8 minutes. Reserve 1 cup pasta water, then drain.

  2. Step 2

    In the same pot, melt butter over medium heat. Add crawfish and Cajun seasoning, stir for 1 minute until fragrant.

  3. Step 3

    Pour in milk and bring to a gentle simmer, stirring occasionally, about 2 minutes.

  4. Step 4

    Remove from heat. Stir in cheddar until melted and smooth, about 1 minute.

  5. Step 5

    Return pasta to the pot. Toss well, adding pasta water a splash at a time until the sauce coats each piece.

  6. Step 6

    Taste and adjust seasoning with salt, pepper, and extra Cajun spice if needed. Serve hot.

Tools you’ll need

  • large pot
  • wooden spoon or whisk
  • measuring cups
  • measuring spoons
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.