CookSnap is coming soon — Join the waitlist →

Crab Curry Powder Stir-Fry

Fresh crab tossed with Thai curry powder, shallots, and lime in a hot wok—crispy edges, aromatic heat, ready in 15 minutes. A showstopper weeknight dinner that tastes like Bangkok street food.

Total time
15 min
Servings
2
Calories
285
Protein
28g
Crab Curry Powder Stir-Fry
freshsimplethaicrabcrispytenderweeknightmain-dish

Ingredients

  • 1 lb fresh crab meat (lump or jumbo)
  • 2 tbsp Thai yellow curry powder
  • 3 medium shallots, thinly sliced
  • 1 whole lime (zested + juiced)
  • 3 tbsp neutral oil
  • 1 tbsp fish sauce
  • 1 whole Thai bird's eye chile, sliced
  • ¼ cup fresh cilantro, chopped

Instructions

  1. 1

    Heat oil in a wok or large skillet over high heat until it shimmers, about 90 seconds.

  2. 2

    Add shallots and sliced chile. Stir constantly for 1 minute until fragrant and edges start to brown.

  3. 3

    Sprinkle curry powder over the pan. Toast for 30 seconds, stirring constantly, until it releases its aroma.

  4. 4

    Add crab meat. Toss gently but constantly for 2–3 minutes until heated through and edges are lightly crisped.

  5. 5

    Pour in fish sauce and lime juice. Toss once more to coat, about 30 seconds.

  6. 6

    Transfer to a plate. Top with lime zest and fresh cilantro. Serve immediately.

Tools you’ll need

  • 14-inch wok or large skillet
  • wooden spoon or wok spatula
  • microplane or zester
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.