CookSnap is coming soon — Join the waitlist →
Back to recipes

Sai Oua Thai Pork Sausage Skillet

Crumbly Thai pork sausage seared with garlic, ginger, and chili, finished with a bright lime-fish sauce glaze. Served over jasmine rice with crispy shallots and fresh herbs for maximum TikTok appeal.

Total time
18 min
Servings
2
Calories
320
Protein
24g
Sai Oua Thai Pork Sausage Skillet
freshsatisfyingthaiporkcrispytenderweeknightmain-dish

Ingredients

  • ¾ lb pork sausage (Thai sai oua, casings removed)
  • 3 cloves garlic, minced
  • 1 tbsp fresh ginger, minced
  • 1 whole Thai red chili, minced (or 0.5 tsp red pepper flakes)
  • 1.5 tbsp fish sauce
  • ½ whole lime (juiced)

Instructions

  1. 1

    Heat oil in a 12-inch skillet over medium-high until shimmering, about 60 seconds.

  2. 2

    Add sausage meat, breaking it into small crumbles with a spoon. Brown for 5–6 minutes until no pink remains.

  3. 3

    Stir in garlic, ginger, and chili. Cook until fragrant, about 45 seconds.

  4. 4

    Pour in fish sauce and squeeze lime juice over top. Toss until evenly coated, 30 seconds.

  5. 5

    Serve over jasmine rice with crispy fried shallots and fresh cilantro or Thai basil.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • cutting board
  • knife
  • small bowl (optional, for lime juicing)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.