Custrd is out on the App Store — Download it free →
Back to recipes

Corn Masa Gorditas

Thick, tender corn masa cakes stuffed with seasoned ground beef, griddled until golden and crisp outside. A hearty, comforting Mexican-style dinner that comes together in about 40 minutes.

Total time
40 min
Servings
4
Calories
480
Protein
25g
Corn Masa Gorditas
comfortingMexicanbeefcrispytenderweeknightmaindinner

Ingredients

  • 2 cups masa harina
  • 1.5 cups warm water
  • 1 tsp salt
  • 1 lb ground beef
  • 1 medium onion
  • 1 tbsp chili powder
  • 2 tbsp vegetable oil

Instructions

  1. 1

    In a large bowl, mix 2 cups masa harina and 1 tsp salt. Gradually add 1.5 cups warm water, stirring until a soft dough forms. Knead for 2 minutes until smooth; cover with a damp towel.

  2. 2

    Heat 1 tbsp oil in a skillet over medium. Add 1 diced onion and cook until soft, about 5 minutes. Add 1 lb ground beef and 1 tbsp chili powder; cook, breaking up meat, until browned, about 8 minutes. Season with salt.

  3. 3

    Divide dough into 8 balls. Flatten each into a 4-inch disc. Place 2 tbsp of beef filling in the center, fold dough over, and pinch edges to seal. Flatten gently to 1/2-inch thick.

  4. 4

    Heat remaining 1 tbsp oil in a large skillet over medium. Cook gorditas in batches, 4 at a time, until golden brown and crisp, about 4 minutes per side. Add more oil if needed.

  5. 5

    Serve warm, split open and stuffed with extra filling, or with your favorite toppings like salsa, cheese, or lettuce.

Tools you’ll need

  • large bowl
  • skillet
  • spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.