Custrd is in beta — Get it free on TestFlight →
Back to recipes

Chicken In Cream Sauce

Tender chicken pieces and crisp-tender broccoli and carrots are enveloped in a rich, creamy sauce, finished with a pat of herb butter for extra flavor.

Total time
30 min
Servings
4
Calories
480
Protein
38g
Chicken In Cream Sauce
comfortingheartyAmericangluten-freechickentendercreamyweeknight dinner

Ingredients

  • 1.5 lb chicken breast
  • 2 cup broccoli florets
  • 1 cup carrots, sliced
  • 1 cup heavy cream
  • ½ cup chicken broth
  • 2 clove garlic, minced
  • 2 tbsp herb butter
  • 1 tbsp olive oil
  • 1 tsp salt
  • ½ tsp black pepper

Instructions

  1. 1

    Season chicken with salt and pepper; heat oil in a large skillet over medium-high.

  2. 2

    Sear chicken until golden and cooked through, about 5-7 minutes per side; remove and set aside.

  3. 3

    In same skillet, sauté garlic for 30 seconds, then add broccoli and carrots; cook 3-4 minutes.

  4. 4

    Pour in broth and cream; bring to a simmer and cook until vegetables are tender, about 5 minutes.

  5. 5

    Return chicken to skillet; simmer 2 minutes to combine flavors.

  6. 6

    Top with herb butter and stir until melted; serve hot.

Tools you’ll need

  • large skillet
  • spatula
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.