Custrd is out on the App Store — Download it free →
Back to recipes

Charred Kielbasa Sheet Pan with Peppers & Onions

Smoky grilled kielbasa with caramelized peppers, onions, and a punchy mustard-vinegar glaze. One sheet pan, 25 minutes, zero fuss.

Total time
25 min
Servings
4
Calories
485
Protein
28g
Charred Kielbasa Sheet Pan with Peppers & Onions
heartycasualpolishporkcrispytenderweeknightgame-day

Ingredients

  • 1.5 lb kielbasa sausage
  • 2 large bell peppers (red, yellow, or mix)
  • 1 large yellow onion
  • 3 tbsp whole grain mustard
  • 2 tbsp apple cider vinegar
  • 2 tbsp olive oil
  • 1 tsp caraway seeds (optional but traditional)

Instructions

  1. 1

    Preheat oven to 450°F. Slice kielbasa on a diagonal into 1-inch-thick coins.

  2. 2

    Cut peppers into 1-inch chunks; slice onion into thick wedges. Toss with oil, salt, and pepper on a sheet pan.

  3. 3

    Scatter kielbasa coins over vegetables. Roast for 12–14 minutes until sausage edges char and vegetables soften.

  4. 4

    Whisk mustard, vinegar, caraway seeds, and a pinch of salt in a small bowl.

  5. 5

    Remove pan from oven. Drizzle glaze over kielbasa and vegetables; toss to coat.

  6. 6

    Serve hot straight from the pan with crusty bread or rye, if you like.

Tools you’ll need

  • sheet pan (18 x 13 inches)
  • small bowl
  • whisk
  • knife and cutting board
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.