CookSnap is coming soon — Join the waitlist →

25-Min Polish Pork & Sauerkraut Skillet

Pork loin seared crispy, then simmered with sauerkraut, tomato, and caraway in one skillet. A Polish bigos stripped down for weeknight speed — tangy, savory, deeply satisfying.

Total time
25 min
Servings
4
Calories
385
Protein
42g
25-Min Polish Pork & Sauerkraut Skillet
comfortheartypolishporktendercrispyweeknightmain-dish

Ingredients

  • 1.25 lb pork loin, cut into 1-inch cubes
  • 2 cups sauerkraut, drained
  • 3 tbsp tomato paste
  • ¾ cup beef or chicken broth
  • 1 tsp caraway seeds
  • 1 tsp smoked paprika
  • 1 medium yellow onion, diced

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering.

  2. 2

    Season pork with salt and pepper. Sear in batches 4–5 minutes total, until browned on edges. Transfer to a plate.

  3. 3

    Add diced onion to the skillet. Cook 2 minutes until softened and fragrant.

  4. 4

    Stir in tomato paste, caraway seeds, and paprika. Cook 1 minute until aromatic.

  5. 5

    Pour in broth and add sauerkraut with the pork. Bring to a simmer, then reduce heat to medium-low and cook 10 minutes until pork is cooked through and flavors meld.

  6. 6

    Taste and adjust salt and pepper. Serve hot in bowls with crusty bread or over rice.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet with lid
  • cutting board
  • chef's knife
  • wooden spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.