Carbonara
A classic Roman pasta dish with spaghetti, crispy cured pork, and a rich, creamy egg sauce.
- Total time
- 25 min
- Servings
- 4
- Calories
- 650
- Protein
- 28g
comfortingItalianporkeggscreamychewyweeknightpasta
Ingredients
- 400 g spaghetti
- 150 g pancetta or guanciale
- 4 large eggs
- 100 g Parmesan cheese
- 1 tsp black pepper
- 1 tbsp salt
- 1 tbsp olive oil
Instructions
- 1
Cook spaghetti in salted boiling water until al dente, reserving 1 cup pasta water.
- 2
In a skillet, cook pancetta with olive oil over medium heat until crispy, about 5 minutes.
- 3
Whisk eggs, grated Parmesan, and black pepper in a bowl until smooth.
- 4
Drain spaghetti and add to skillet with pancetta, tossing to coat.
- 5
Remove from heat, quickly stir in egg mixture, adding pasta water to create a creamy sauce.
- 6
Serve immediately with extra Parmesan and pepper.
Tools you’ll need
- large pot
- skillet
- mixing bowl
- whisk
- colander
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
