CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Caramelized Fish with Rice & Greens

Crispy-edged fish braised in a sweet-salty caramel sauce with bitter melon beef and fresh greens on the side. A complete Vietnamese weeknight dinner in one skillet.

Total time
20 min
Servings
2
Calories
385
Protein
38g
20-Min Caramelized Fish with Rice & Greens
comfortsatisfyingvietnamesefishcrispytenderjuicyweeknight

Ingredients

  • ¾ lb white fish fillets (catfish, snapper, or cod)
  • 2 tbsp granulated sugar
  • 2 tbsp fish sauce
  • ½ cup beef with bitter melon (pre-cooked or rotisserie beef)
  • 2 cups steamed white rice
  • 2 cups fresh salad greens (arugula, lettuce, or mixed)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Add sugar and stir until it dissolves and turns golden, about 2 minutes — watch it carefully.

  3. 3

    Pour in fish sauce, then slide the fish fillets into the skillet without stirring them.

  4. 4

    Cook for 6–7 minutes without moving; the edges should look opaque and caramelized on the bottom.

  5. 5

    Warm the cooked beef mixture in a small bowl or on the side of the skillet while the fish finishes.

  6. 6

    Serve the fish with rice, warmed beef, fresh greens, and a drizzle of pan sauce on top.

Tools you’ll need

  • 12-inch skillet with lid
  • small bowl
  • wooden spoon
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Vietnamese recipes →