Custrd is out on the App Store — Download it free →
Back to recipes

Bulgogi Cheese Steak

A quick fusion of Korean bulgogi flavors and a classic cheese steak, with sweet-savory beef, caramelized onions, and melted cheese in a toasted bun.

Total time
20 min
Servings
2
Calories
650
Protein
45g
Bulgogi Cheese Steak
comfort foodkorean-americanbeeftendermeltyweeknightsandwichdinner

Ingredients

  • 1 lb thinly sliced beef (such as ribeye or sirloin)
  • 1 large onion
  • 3 tbsp soy sauce
  • 2 tbsp brown sugar
  • 4 slices provolone cheese slices
  • 2 hoagie rolls

Instructions

  1. 1

    In a bowl, mix the 3 tbsp soy sauce and 2 tbsp brown sugar until dissolved. Add the 1 lb beef and toss to coat; set aside.

  2. 2

    Heat a large skillet over medium-high. Add the 1 sliced onion and cook, stirring, until soft and golden, about 5 minutes. Transfer to a plate.

  3. 3

    Add the beef to the hot skillet in a single layer. Cook without stirring for 2 minutes, then flip and cook until browned and cooked through, about 2 more minutes.

  4. 4

    Return the onions to the skillet, stir to combine, and cook for 1 minute until hot. Divide the mixture between the 2 hoagie rolls.

  5. 5

    Top each with 2 slices of provolone. Broil or toast in the skillet until the cheese melts and bubbles, about 2 minutes. Serve hot.

Tools you’ll need

  • large skillet
  • mixing bowl
  • spatula
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.