Custrd is out on the App Store — Download it free →
Back to recipes

Brazilian Hidden Beef Casserole

A quick and comforting casserole with shredded beef, roasted potatoes, and melted cheese, topped with fried plantains and fresh herbs.

Total time
25 min
Servings
4
Calories
550
Protein
35g
Brazilian Hidden Beef Casserole
comfortingbrazilianbeefcreamycrispyweeknightcasseroledinner

Ingredients

  • 1 lb shredded cooked beef
  • 1.5 lb potatoes
  • 2 plantains
  • 1 cup shredded cheese (e.g., mozzarella)
  • 2 tbsp olive oil
  • 0 salt and pepper

Instructions

  1. 1

    Preheat oven to 400°F. Peel and slice potatoes into 1/4-inch rounds. Toss with 1 tbsp olive oil, salt, and pepper. Arrange in a baking dish and roast for 15 minutes until just tender.

  2. 2

    While potatoes roast, peel and slice plantains into 1/2-inch rounds. Heat 1 tbsp olive oil in a skillet over medium-high. Fry plantains until golden brown, about 3 minutes per side. Set aside.

  3. 3

    Spread the 1 lb shredded beef evenly over the roasted potatoes. Top with 1 cup shredded cheese.

  4. 4

    Bake for 10 minutes until cheese is melted and bubbly. Garnish with fried plantains and chopped parsley or red chili if desired.

Tools you’ll need

  • baking dish
  • skillet
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.