CookSnap is coming soon — Join the waitlist →
Back to recipes

Belgian Fish Waterzooi

A creamy Belgian stew of tender white fish and vegetables in a silky broth, finished with egg and cream. Warmly spiced and soul-satisfying comfort in a bowl.

Total time
45 min
Servings
4
Calories
395
Protein
42g
Belgian Fish Waterzooi
comfortcozybelgianfishcreamytenderweeknightcomfort-food-night

Ingredients

  • 1.5 lb white fish fillets (cod, haddock, or halibut)
  • 3 tbsp butter
  • 3 medium leeks, white and light green parts
  • 2 medium carrots
  • 2 medium celery stalks
  • 4 cups fish or chicken stock
  • ½ cup heavy cream
  • 2 whole egg yolks
  • 1 to taste salt, pepper, and fresh parsley or dill

Instructions

  1. 1

    Cut the leeks lengthwise from root to tip, then lay each half flat and slice crosswise into 0.5-inch-wide pieces, creating half-moon shapes about as thick as a pencil.

  2. 2

    Cut the carrots at a slight angle into 0.25-inch-thick slices, like roof tiles, so they cook quickly and look elegant.

  3. 3

    Cut the celery stalks crosswise into 0.5-inch pieces, roughly the size of your pinky finger width.

  4. 4

    Pat the fish fillets dry with paper towels, then cut them into 2-inch chunks, removing any small bones you feel with your fingers.

  5. 5

    Melt 3 tablespoons of butter in a large pot over medium heat until it foams and the foam subsides, about 1 minute.

  6. 6

    Add the leeks, carrots, and celery to the melted butter; stir once every 30 seconds until the vegetables soften slightly and the leeks turn translucent, about 4 minutes.

  7. 7

    Pour in 4 cups of stock and raise the heat to medium-high until small bubbles break at the surface continuously, about 4 minutes.

  8. 8

    Reduce heat to medium-low so the liquid barely simmers, then gently place the fish chunks into the broth.

  9. 9

    Cook until the fish flakes easily when pressed with a fork and turns opaque throughout, about 6 minutes.

  10. 10

    Pour the cream into a small bowl, then whisk in the 2 egg yolks until completely blended and uniform in color.

  11. 11

    Slowly pour the cream mixture into the simmering pot while stirring gently with a wooden spoon to prevent the eggs from scrambling, about 1 minute.

  12. 12

    Continue stirring gently over medium-low heat until the broth thickens slightly and coats the back of a spoon, about 2 minutes.

  13. 13

    Taste the stew and sprinkle in salt and pepper a little at a time until it tastes savory and balanced to you.

  14. 14

    Ladle the stew into four deep bowls, dividing the fish and vegetables evenly, then scatter fresh parsley or dill over each bowl.

Tools you’ll need

  • large heavy-bottomed pot (5-quart minimum)
  • cutting board
  • chef's knife
  • paper towels
  • small bowl
  • whisk
  • wooden spoon
  • ladle
  • four deep serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.