CookSnap is coming soon — Join the waitlist →
Back to recipes

Japanese Chicken Cream Stew

Creamy, aromatic chicken stew with potato, carrot, and onion in a silky Japanese-style broth. Ready in under 40 minutes for a weeknight comfort meal.

Total time
35 min
Servings
4
Calories
385
Protein
35g
Japanese Chicken Cream Stew
comfortcozyjapanesechickencreamytenderweeknightcomfort-food-night

Ingredients

  • 1 lb boneless, skinless chicken breast
  • 2 tbsp butter
  • 1 large onion
  • 2 medium carrot
  • 2 medium potato
  • 4 cups chicken stock
  • ¾ cup heavy cream
  • ¼ cup sake or dry white wine
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Cut chicken into 1-inch cubes. Slice onion into thin wedges.

  2. 2

    Cut carrot and potato into 1-inch chunks.

  3. 3

    Melt butter in a large pot over medium-high heat until foaming, about 1 minute.

  4. 4

    Add chicken pieces and cook without stirring for 2 minutes until lightly browned.

  5. 5

    Stir chicken, breaking up any clusters. Cook 3 more minutes until mostly opaque.

  6. 6

    Add onion and carrot. Stir and cook until onion begins to soften, about 2 minutes.

  7. 7

    Pour in stock and sake. Add potato. Bring to a boil, then reduce to medium-low.

  8. 8

    Simmer uncovered until potato is fork-tender and chicken is cooked through, 15 minutes.

  9. 9

    Stir in cream. Simmer 2 minutes more without boiling. Season with salt and pepper.

  10. 10

    Ladle into bowls. Serve hot with steamed rice on the side.

Tools you’ll need

  • large pot with lid
  • cutting board
  • sharp chef's knife
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.