CookSnap is coming soon — Join the waitlist →

25-Min Lemon Chicken Soup with Crispy Croutons

Silky Greek-style chicken and rice soup brightened with lemon and egg, finished with a tangy dollop of sour cream. Crispy croutons add the perfect crunch.

Total time
25 min
Servings
4
Calories
385
Protein
28g
25-Min Lemon Chicken Soup with Crispy Croutons
comfortcozygreekchickencreamytendercrispyweeknight

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 6 cups chicken broth
  • 2 medium carrots, sliced into thin rounds
  • ½ cup white rice
  • 2 whole lemon (juiced)
  • 2 whole eggs
  • ½ cup sour cream
  • 1 cup croutons

Instructions

  1. 1

    Pour broth into a large pot and bring to a rolling boil over medium-high heat, ~3 minutes.

  2. 2

    Add carrots and rice, then lower heat to medium and simmer until rice is tender, ~12 minutes.

  3. 3

    Stir in shredded chicken and lemon juice, then remove from heat and let cool 1 minute.

  4. 4

    Whisk eggs in a bowl, then slowly drizzle into the soup while stirring constantly to create a silky texture.

  5. 5

    Season with salt and pepper to taste, then ladle into bowls.

  6. 6

    Top each bowl with a spoonful of sour cream and a handful of croutons, then serve immediately.

Tools you’ll need

  • large pot (6-quart)
  • wooden spoon or ladle
  • small mixing bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.