CookSnap is coming soon — Join the waitlist →

Avgolemono — Creamy Lemon Chicken Soup

Silky Greek lemon-egg soup with shredded chicken, rice, and bright citrus tang. Ready in 25 minutes — no cream needed, just eggs and lemon magic.

Total time
25 min
Servings
4
Calories
285
Protein
32g
Avgolemono — Creamy Lemon Chicken Soup
comfortfreshgreekchickencreamysilkytenderweeknight

Ingredients

  • 1 whole (about 3 cups shredded) rotisserie chicken
  • 6 cups chicken broth
  • ½ cup white rice
  • 3 whole large eggs
  • 2 whole (juiced) lemon
  • ½ whole yellow onion
  • 3 tbsp (chopped) fresh dill or parsley

Instructions

  1. 1

    Bring broth to boil in a large pot. Add rice and halved onion; simmer 12 minutes until rice is tender.

  2. 2

    Shred rotisserie chicken into bite-sized pieces. Remove onion from pot and discard.

  3. 3

    Whisk eggs in a bowl with juice from both lemons until pale, about 1 minute.

  4. 4

    Reduce heat to low. Slowly ladle hot broth into the egg mixture while whisking constantly to temper the eggs.

  5. 5

    Pour the egg-broth mixture back into the pot, stirring gently. Add shredded chicken and stir until combined.

  6. 6

    Serve in bowls topped with fresh dill. Do not boil after adding eggs or they will scramble.

Tools you’ll need

  • large pot (4-quart or larger)
  • whisk
  • wooden spoon or stirring spoon
  • ladle
  • bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.