CookSnap is coming soon — Join the waitlist →

20-Min Lemon Chicken Soup

Creamy avgolemono—Greek lemon chicken soup—ready in 20 minutes with rotisserie chicken and store-bought broth. Bright, tangy, silky finish from egg yolks and lemon juice.

Total time
20 min
Servings
4
Calories
285
Protein
28g
20-Min Lemon Chicken Soup
comfortfreshgreekchickencreamysilkyweeknightcomfort-food-night

Ingredients

  • 1.5 cups rotisserie chicken, shredded
  • 6 cups chicken broth
  • ½ cup short-grain rice (arborio or sushi rice)
  • 2 whole lemon (juiced + zested)
  • 3 whole eggs
  • 2 tbsp fresh dill, chopped
  • ½ whole yellow onion, diced fine

Instructions

  1. 1

    Heat broth and diced onion in a pot over medium-high heat until simmering, about 4 minutes.

  2. 2

    Stir in rice and shredded chicken, then simmer uncovered until rice is tender, 12–14 minutes.

  3. 3

    Whisk eggs in a bowl with lemon juice until smooth. Remove pot from heat.

  4. 4

    Slowly pour egg mixture into hot broth while stirring constantly; the soup will become silky and creamy.

  5. 5

    Stir in lemon zest and dill. Season with salt and pepper to taste.

  6. 6

    Serve hot immediately; do not return to heat or eggs will scramble.

Tools you’ll need

  • large pot (4–5 quart)
  • small bowl
  • whisk
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.