CookSnap is coming soon — Join the waitlist →
Back to recipes

Bánh Chuối — Crispy Banana Fritters

Golden, crispy Vietnamese banana fritters made with a delicate rice-flour batter. Served warm with a touch of sweetness—a beloved street snack or light dessert.

Total time
20 min
Servings
2
Calories
285
Protein
2g
Bánh Chuối — Crispy Banana Fritters
casualindulgentvietnamesevegetariancrispyfluffysnackweekend

Ingredients

  • 2 medium ripe bananas
  • ½ cup rice flour
  • 2 tablespoons sugar
  • ½ cup water
  • 2 cups vegetable oil for frying
  • ¼ teaspoon salt

Instructions

  1. 1

    Peel the bananas and place them on a cutting board. Slice each banana lengthwise down the middle, creating two long halves. Then slice each half crosswise into 3-inch-long pieces, about the size of your pinky finger.

  2. 2

    Pour the rice flour into a medium bowl. Add the sugar and salt to the flour, then stir with a fork or whisk until mixed evenly, about 15 seconds.

  3. 3

    Pour the water into the flour mixture slowly while whisking with a fork. Whisk until the batter looks smooth and thin, like pancake batter with no lumps, about 30 seconds.

  4. 4

    Pour the vegetable oil into a heavy-bottomed pot or deep skillet until it reaches a depth of 2 inches. Place the pot on the stove over medium-high heat and let it warm until the oil shimmers and a wooden spoon dipped in it produces steady bubbles, about 3 minutes.

  5. 5

    Working with one banana piece at a time, dip it into the batter to coat all sides. Carefully slide it into the hot oil—you should hear an immediate sizzle. Fry only 3–4 pieces at a time so they have room to move.

  6. 6

    Watch the banana pieces as they fry. After about 90 seconds, when the surface turns golden brown and crispy like caramelized sugar, use a slotted spoon to flip each one carefully.

  7. 7

    Fry the second side for another 90 seconds until it matches the first side—both sides should be a warm golden-brown color. Using the slotted spoon, lift each fritter out and place it on a paper-towel-lined plate.

  8. 8

    Repeat steps 5–7 with the remaining banana pieces, working in batches of 3–4. Allow the oil to return to a shimmering state between batches, about 30 seconds.

  9. 9

    Transfer the warm fritters to a serving plate or individual plates. Serve immediately while still crispy, within 5 minutes of frying for the best texture.

Tools you’ll need

  • cutting board
  • sharp knife
  • medium mixing bowl
  • fork or whisk
  • heavy-bottomed pot or deep skillet (3-quart minimum)
  • wooden spoon
  • slotted spoon or spider strainer
  • paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.