CookSnap is coming soon — Join the waitlist →

Spicy Awaze Beef & Cauliflower Skillet

Tender seared beef with charred cauliflower in a fiery Ethiopian awaze sauce — ginger, garlic, and chili heat in under 20 minutes. Serve with injera or rice.

Total time
20 min
Servings
2
Calories
385
Protein
38g
Spicy Awaze Beef & Cauliflower Skillet
boldsatisfyingethiopianbeefcrispytendercharredweeknight

Ingredients

  • 1 lb beef sirloin or ribeye, cut into 1-inch cubes
  • 4 cups cauliflower florets
  • 2 tbsp ginger, minced
  • 4 cloves garlic, minced
  • 2 tbsp berbere spice blend or chili powder
  • 2 tbsp red wine vinegar
  • 1.5 tbsp tomato paste

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering.

  2. 2

    Sear beef cubes 2 minutes per side without stirring — edges should be browned. Transfer to a plate.

  3. 3

    Add cauliflower to the same skillet, cook 3 minutes stirring occasionally until edges char.

  4. 4

    Stir in ginger and garlic, cook 30 seconds until fragrant — don't let it burn.

  5. 5

    Add berbere, tomato paste, and vinegar; stir to coat. Return beef to skillet.

  6. 6

    Add 1/4 cup water, stir, and simmer 2 minutes until sauce coats the beef. Taste and adjust salt.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.