CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Chili Crisp Beef Anticuchos

Peruvian grilled beef skewers with a punchy cumin-chili marinade, finished with bright lime and crispy chili oil. Sheet-pan seared and served with charred onions and boiled potatoes.

Total time
25 min
Servings
4
Calories
385
Protein
38g
Chili Crisp Beef Anticuchos
boldsatisfyingperuvianbeefcharredtendercrispyweeknight

Ingredients

  • 1.5 lb beef sirloin or chuck, cut into 1.5-inch cubes
  • 1.5 tsp cumin
  • 1 tsp paprika
  • ¾ tsp chili flakes or chili powder
  • 3 tbsp white vinegar
  • 1 large yellow onion, cut into thick wedges
  • 1 whole lime
  • 2 tbsp chili crisp (store-bought or use extra olive oil mixed with red pepper flakes)

Instructions

  1. 1

    Toss beef cubes with cumin, paprika, chili flakes, vinegar, salt, and pepper in a bowl until coated.

  2. 2

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, about 1 minute.

  3. 3

    Sear beef in batches without stirring until deeply browned on two sides, 2 minutes per side. Transfer to a plate.

  4. 4

    Add onion wedges to the skillet and char until edges blacken and they soften, 3–4 minutes, stirring halfway.

  5. 5

    Return beef to the skillet, squeeze lime juice over everything, and toss to coat.

  6. 6

    Drizzle with chili crisp and serve hot with lime wedges and fleur de sel on the side.

Tools you’ll need

  • large bowl
  • large cast-iron skillet or heavy 12-inch skillet
  • tongs or metal spatula
  • cutting board and sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.